Sign In | Join Free | My futurenowinc.com
futurenowinc.com
Products
Search by Category
Home > Chemicals > Basic Organic Chemicals > Organic Salt >

Cas No 141732 76 5

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cas no 141732 76 5

    All cas no 141732 76 5 wholesalers & cas no 141732 76 5 manufacturers come from members. We doesn't provide cas no 141732 76 5 products or service, please contact them directly and verify their companies info carefully.

    Total 82 products from cas no 141732 76 5 Manufactures & Suppliers
    Wholesale Prevent Hair Loss Lyophilized Powder Copper Peptide CAS 49557 75 7 GHK - CU from china suppliers

    Brand Name:BIOF

    Model Number:49557-75-7

    Place of Origin:Xi'an , China

    ...-75-7 GHK - CU What Is Copper Peptide ? Name: GHK-Cu (Copper peptide) CAS: 49557-75-7 Formula : Gly-His-Lys-2Cu Appearance: blue powder purity; 98%MIN Assay: HPLC;...

    Xi'an Biof Bio-technology Co.,Ltd
    Verified Supplier

    Wholesale cGMP peptide Exenatide Acetate cas no 141732-76-5 from china suppliers

    Brand Name:Hangzhou Peptide Biochem Co.,Ltd

    Place of Origin:China

    ...Product Name CAS No. Salcitonin Acetate 47931-85-1 Glucagon 16941-35-2 Pramlintide 196078-30-5 Sermorelin 86168-78-7 Deslorelin ...

    Hangzhou Peptide Biochem Co., Ltd
    Active Member

    Zhejiang

    Wholesale Peptide synthesis  API powder Exenatide Acetate /  Exenatida  CAS 141732-76-5 from china suppliers

    Brand Name:Youngshe Peptide

    Model Number:Cas No:141732-76-5

    Place of Origin:China

    ...Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also ...

    Chengdu youngshe chemical Co,.Ltd
    Active Member

    Wholesale Exendin-4, Exenatide, 141732-76-5, 141758-74-9 from china suppliers

    Brand Name:cellmano

    Model Number:E-0902

    Place of Origin:china

    ...-Gly-Ala-Pro-Pro-Pro-Ser-NH2 E-0902 Exendin-4, Exenatide C184H282N50O60S 4186.60 141758-74-9/141732-76-5 H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu...

    Cellmano Biotech Limited
    Active Member

    Wholesale exenatide Acetate CAS.141732-76-5 from china suppliers

    Brand Name:YS

    Model Number:YSAP

    Place of Origin:China

    ...Exenatide Acetate Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also ...

    Chengdu YoungShe Chemical Co.,Ltd
    Site Member

    Sichuan

    Wholesale Exenatide Acetate | Exenatide | CAS 141732-76-5 from china suppliers

    Categories:Rutile Titanium Dioxide

    Telephone:+86-202-96321452

    Country/Region:china

    ...Exenatide Acetate | Exenatide | CAS 141732-76-5 ADD TIME: 2016-09-20 13:19:03 view count: 197clicks product info Exenatide Acetate /Exenatide/141732-76-5 1.Product Name : Exenatide Acetate /Exenatide/141732-76-5 2.Appearance :White powder 3....

    chinafactorys company
    ICP Remarked Supplier

    Wholesale High Specification Exenatide Acetate CAS 141732-76-5 from china suppliers

    Categories:High Purity Nitrogen Generator

    Telephone:86-576-88851661

    Country/Region:china

    High Specification Exenatide Acetate CAS 141732-76-5 High Specification Exenatide Acetate CAS 141732-76-5 Share to Payment Type: T/T,L/C Min. Order: 1 Gram Delivery Time: 10 Days Mr. Tommy Chat Now Contact Now Add to Basket

    Conbottpharm limited
    ICP Remarked Supplier

    Wholesale Exenatide acetate CAS:141732-76-5 / sucy@chembj.com from china suppliers

    Place of Origin:China

    Brand Name:Huao

    Model Number:sucy@chembj.com

    ... E -mail:sucy@ycphar.com Whatsapp:+8613419639982 http://www.servechemical.com / www.providepharmacy.com Exenatide acetate CAS:141732-76-5 Product Name:Exenatide acetate Synonyms:EXENATIDE ACETATE;ENFUVIRTIDE ACETATE;Exenatide;His-Gly-Gly-Gly-Thr...

    Guangzhou Huao Chemical Co,Ltd
    Site Member

    Guangdong

    Wholesale Exenatide acetate 141732-76-5 from china suppliers

    Categories:API Chemical

    Telephone:86-27-59207850

    Country/Region:china

    Product name:Exenatide acetate CAS:141732-76-5 Appearance:White powder Molecular Formula:C184H282N50O60S Molecular Weight:4186.6

    WuHan Fortuna Chemical Co., Ltd
    Active Member

    Hubei

    Wholesale Exenatide from china suppliers

    Categories:Sodium Methylate

    Telephone:+86 592 5365887

    Country/Region:china

    ...customers have already purchased this product.] Share | Products NameExenatide CAS No.: 141732-76-5 Molecular FormulaC184H282N50O60S Product Description: Exenatide is one of a new class of medications approved for the ...

    Green Stone Swiss Co ., ltd.
    ICP Remarked Supplier

    Wholesale Peptide APIs Exenatide Acetate from china suppliers

    Categories:Other APIS

    Telephone:027-81302488

    Country/Region:china

    Products: Exenatide Acetate Synonyms: Exenatide Acetate Cas No.: 141732-76-5 Molecular Formula: C187H282N50O60S Molecular Weight: 4186.6 Molecular Structure: Exenatide Acetate Cas No141732-76-5

    Wuhan dong kangyuan technology co.,ltd
    ICP Remarked Supplier

    Wholesale peptide APIs,cosmetic peptides, veterinary peptides, custom peptides from china suppliers

    Categories:custom peptide

    Telephone:86-0755-86350848

    Country/Region:china

    ...68630-75-1 Calcitonin Acetate(Salmon) Cas No:47931-85-1 Carbetocin Acetate Cas No:37025-55-1 Carperitide Acetate Cas No:89213-87-6 Cetrorelix Acetate Cas No:120287-85-6 Desmopressin Acetate Cas No:16789-98-3 Deslorelin Acetate...

    Shenzhen JYMed Technology Co., Ltd
    Active Member

    Guangdong

    Wholesale Exenatide acetate from china suppliers

    Categories:Glass Vial

    Telephone:+86-21-54176788

    Country/Region:china

    ...Name:Exenatide acetate CAS NO:141732-76-5 Usages:peptides Product Introduction: Name Exenatide acetate Molecular Structure Molecular Formula C184H282N50O60S.C2H4O2 Molecular Weight 4262.67 CAS Registry Number 141732-76-5 SPECIFICATIONS: 1 .Appearance :...

    ShangHai Yeexin Biochem&Tech Co.,Ltd
    ICP Remarked Supplier

    Wholesale Exenatide Acetate from china suppliers

    Categories:Peptide Powder

    Telephone:+86 592 5365887

    Country/Region:china

    ....] <> [Products Name] Exenatide Acetate [Molecular Formula]C187H282N50O60S [CAS No.] 141732-76-5 [Product Description] Appearance :White powder Water Content(Karl Fischer)5.0% Acetate Content(by HPLC)12...

    Green Stone Switzerland Co., Ltd
    ICP Remarked Supplier

    Wholesale Exenatide Acetate Glutamine Peptides from china suppliers

    Categories:Peptide Powder

    Telephone:86-27-83912198

    Country/Region:china

    .... Key Points: Good results Minimum side effects Extended shelf life No adulteration Full nameExenatide Acetate Cas No.141732-76-5 Sequence: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln...

    HUBEI HANWAYS PHARCHEM CO., LTD.
    ICP Remarked Supplier

    Wholesale Exenatide Acetate from china suppliers

    Categories:Polyclonal Antibody

    Telephone:0551-68569700

    Country/Region:china

    ...-Pro-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Molecular Formula: C187H282N50O60S Molecular Weight: 4186.6 Cas No: 141732-76-5 Quick Inquiry * Email * Content * Captcha Related Products Tetracosactide Acetate Vapreotide Acetate Teriparatide Acetate Gonadorelin...

    Anhui Rubiox-Vision Biotechnology Co., LTD
    ICP Remarked Supplier

    Wholesale Generic APIS Exenatide from china suppliers

    Categories:Food Grade Acetic Acid

    Telephone:86-571-89197072, 88760071, 56926326

    Country/Region:china

    ...Name Exenatide Full nameExenatide Acetate Cas No.141732-76-5 Sequence: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-...

    Hangzhou Peptide Biochem Co., Ltd
    ICP Remarked Supplier

    Wholesale Dolutegravir GSK1349572 Exennatide Acetate from china suppliers

    Categories:Propylene Glycol Monomethyl Ether Acetate

    Telephone:+86-21-50793966

    Country/Region:china

    Chemical Name: Exennatide Acetate Cas No.: 141732-76-5 Molecular Formula: C184H282N50O60S.C2H4O2 Molecular Weight: 4262.67 Molecular Structure:

    synfarm limited
    ICP Remarked Supplier

    Wholesale Dolutegravir GSK1349572 from china suppliers

    Categories:Quinoline

    Telephone:+86-21-50793966

    Country/Region:china

    Products Chemical Name: Exennatide Acetate Cas No.: 141732-76-5 Molecular Formula: C184H282N50O60S.C2H4O2 Molecular Weight: 4262.67 Molecular Structure:

    Shanghai SynFarm Pharmaceutical Technology Co., Ltd
    ICP Remarked Supplier

    Wholesale Exenatide Acetate from china suppliers

    Categories:Peptide Powder

    Country/Region:china

    ...Exenatide Acetate Exenatide Acetate Product Name Exenatide Acetate Cas No. 141732-76-5 Molecular Formula C186H284N50O62S Molecular Weight 4244.61 GT # GT Name Sequence His-Gly-Gly-Gly-...

    GENTLE-BIO limited
    ICP Remarked Supplier

    Inquiry Cart 0