Sign In | Join Free | My futurenowinc.com
futurenowinc.com
Products
Search by Category
Home > Chemicals > Agrochemicals > Agrochemicals & Pesticides Products >

Growth Hormone Releasing Factor

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    growth hormone releasing factor

    All growth hormone releasing factor wholesalers & growth hormone releasing factor manufacturers come from members. We doesn't provide growth hormone releasing factor products or service, please contact them directly and verify their companies info carefully.

    Total 80 products from growth hormone releasing factor Manufactures & Suppliers
    Wholesale Bodybuilding Releasing Peptides Synthetic Growth Hormone Tesamorelin CAS 218949-48-5 from china suppliers

    Brand Name:SGH

    Model Number:218949-48-5

    Place of Origin:China

    ...: Tesamorelin, (formerly known as TH9507), is a type of peptide called a growth hormone-releasing factor (GHRF). Tesamorelin / Egrifta is a synthetic form of growth-hormone-releasing hormone which is used in the treatment of HIV-associated lipodystrophy...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale peptides , white, CAS:841205-47-8,powder,liquid,Aceto-sterandryl,gaining muscle ,steroids,bodybuilding,fat loss, from china suppliers

    Brand Name:YC

    Model Number:140703-51-1

    Place of Origin:WhatsAPP:+86 13357185418

    ...29 86168-78-7 Growth Hormone peptide fragment Pentadecapeptide BPC 157 137525-51-0 CJC-1295 Acetate 863288-34-0 Melanotan I I 75921-69-6 GHRP-6 (Growth hormone releasing peptide) 87616-84-0 GHRP-2 (Pralmorelin),Growth Hormone Releasing Peptide-2 158861-67...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Wholesale Sandwich Mouse Elisa Kit 3 Hydroxy 3 Methylglutaryl Coenzyme A Reductase from china suppliers

    Place of Origin:China

    Brand Name:DLdevelop

    Sandwich Mouse Elisa Kit 3 Hydroxy 3 Methylglutaryl Coenzyme A Reductase Product Detail Product Tags Product name: Mouse 3-Hydroxy-3-Methylglutaryl Coenzyme A Reductase (HMGCR) ELISA Kit Method: Sandwich Synonyms: HMG-CoA Reductase; Hydroxymethylglutaryl-...

    Wuxi Donglin Sci & Tech Development Co.,Ltd.
    Verified Supplier

    Jiangsu

    Wholesale CAS 66004-57-7 HGH Human Growth Hormone Fragment 176-91  For Bodybuilding and Fat Loss from china suppliers

    Brand Name:SGH

    Model Number:66004-57-7

    Place of Origin:China

    ...: HGH Frag 176-191, a polypeptide with amino acid sequence YLRIVQCRSVEGSCGF, is an analog of the growth hormone- releasing factor (GHRF) which signals the effects of growth hormone (GH). It is a 15-mer peptide

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Bodybuilding Supplements Growth Hormones For Adults AOD9604 CAS 221231-10-3 from china suppliers

    Brand Name:SGH

    Model Number:221231-10-3

    Place of Origin:China

    Cas No. 221231-10-3 Synonyms: AOD 9604 Molecular Formula: C78H123N23O23S2 MW: 1815.1 Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe one disulfide bond. Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: AOD9604 is a ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale HGH 176-191 Human Growth Hormone Products Muscle Building Peptides  CAS 66004 57 7 from china suppliers

    Brand Name:SGH

    Model Number:66004-57-7

    Place of Origin:China

    ...: HGH Frag 176-191, a polypeptide with amino acid sequence YLRIVQCRSVEGSCGF, is an analog of the growth hormone- releasing factor (GHRF) which signals the effects of growth hormone (GH). It is a 15-mer peptide

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation from china suppliers

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Labeled Riptropin High Pure Human Growth Hormone Cas NO 12629-01-5 Muscle Building from china suppliers

    Brand Name:SGH

    Model Number:CAS No: 12629-01-5

    Place of Origin:China

    ...Labeled Riptropin High Pure Human Growth Hormone Cas NO 12629-01-5 Muscle Building Cas No. 12629-01-5 Labels: Riptropin Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale High Pure IGF Growth Hormone Labeled Riptropin Cas NO 12629-01-5 For Body Builder from china suppliers

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    ...High Pure IGF Growth Hormone Labeled Riptropin Cas NO 12629-01-5 For Body Builder Cas No. 12629-01-5 Labels: Riptropin Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Muscle Growth Human Growth Hormone 12629-01-5 For Bodybuilding Functions from china suppliers

    Brand Name:SGH

    Model Number:CAS No: 12629-01-5

    Place of Origin:China

    ...Muscle Growth Human Growth Hormone 12629-01-5 For Bodybuilding Functions Cas No. 12629-01-5 Size: 5iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Bodybuilding Labeled Strongtropin HGH Human Growth Hormone For Bodybuilding Functions 12629 01 5 from china suppliers

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Weight Loss Human Growth Hormone Muscle Gain Bodybuilding CAS 12629 01 5 from china suppliers

    Brand Name:SGH

    Model Number:CAS No: 12629-01-5

    Place of Origin:China

    ...Weight Loss Human Growth Hormone Muscle Gain Bodybuilding CAS 12629 01 5 Cas No. 12629-01-5 Size: 5iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Bodybuilding HGH Human Growth hormone CAS 12629 01 5 Synthetic Growth Hormone For Muscle Mass from china suppliers

    Brand Name:SGH

    Model Number:CAS No: 12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 5iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain from china suppliers

    Brand Name:SGH

    Model Number:86168-78-7

    Place of Origin:China

    Cas No. 86168-78-7 Synonyms: Sermorelin Acetate Molecular Formula: C149H246N44O42S MW: 3357.88 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Sermorelin Acetate Muscle Building Growth Hormone In Humans Peptides Sermorelin CAS 86168-78-7 GRF 1-29 from china suppliers

    Brand Name:SGH

    Model Number:86168-78-7

    Place of Origin:China

    Cas No. 86168-78-7 Synonyms: Sermorelin Acetate Molecular Formula: C149H246N44O42S MW: 3357.88 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Human Coagulation Factor VIII from china suppliers

    Categories:Human Growth Hormone Injections

    Telephone:52644600

    Country/Region:china

    ...Learning from challenges we encountered early on, the Jiangsu kangyuanqinna Medicine Company is now evolving rapidly. We’ve established a mature synergy that has enabled ...

    the Jiangsu kangyuanqinna Medicine Company
    ICP Remarked Supplier

    Wholesale Sermorelin from china suppliers

    Categories:Products

    Telephone:86 - 25 - 83310216

    Country/Region:china

    ...Product name: Sermorelin Package: 1G/BOTTLE Purity: 98% Min Validity: 20 days Delivery: Promptly Growth Hormone Releasing Factor Fragment 1-29 amide human H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- ...

    Sinoway International
    ICP Remarked Supplier

    Jiangsu

    Wholesale L-ALPHA-GLYCERYLPHOSPHORYLCHOLINE 85% Liquid (GPC) from china suppliers

    Place of Origin:China

    Brand Name:CIMA

    Model Number:50%, 85%, 99%

    Alpha GPC Introduction We are the only supplier for 50% Granular powder in China, it's using embedding technique and 100% none Hygroscopicity) Basic information: Product name: Choline glycerophosphate, Choline Alfoscerate Other name: Alpha GPC, L-ALPHA-...

    Wuxi Cima Science Co.,Ltd
    Active Member

    Jiangsu

    Wholesale Tianeptine Sodium 98.5% Min Nootropics Powder 30123-17-2 Animal Medicine from china suppliers

    Brand Name:New Star

    Model Number:30123-17-2

    Place of Origin:China mainland

    Tianeptine Sodium 98.5% Min Nootropics Powder 30123-17-2 Animal Medicine Tianeptine Description: HP8115 Tianeptine acid CAS 66981-73-5 Tianeptine acid CAS 66981-73-5 CAS 66981-73-5 Brand: Wison MW:436.95 MSDS: Avaiable MF : C21H25ClN2O4S EINECS:ND Purity:...

    Newstar Chemical Co. Ltd
    Active Member

    Jiangsu

    Wholesale Antistress sleep-promoting Shui chan an kang bao from china suppliers

    Categories:Insulin-like Growth Factors

    Telephone:0086-510-81013856,81013896

    Country/Region:china

    ...the blood integrity, and promote growth hormone, gastrin, neuropeptide Y, insulin-like growth factor, central nervous inhibitory neurotransmitter, such as hormone secretion and improve aquatic animal body metabolic rate and promote growth, Not sensitive to...

    (JOINT VENTURE)WU XI ENERTE BIOLOGICAL TECHNOLOGY CO.,LTD
    ICP Remarked Supplier

    Jiangsu

    Inquiry Cart 0