Sign In | Join Free | My futurenowinc.com
futurenowinc.com
Products
Search by Category
Home > Chemicals > Chemical Reagent Products >

Hgh Human Growth Hormone

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    hgh human growth hormone

    All hgh human growth hormone wholesalers & hgh human growth hormone manufacturers come from members. We doesn't provide hgh human growth hormone products or service, please contact them directly and verify their companies info carefully.

    Total 10947 products from hgh human growth hormone Manufactures & Suppliers
    Wholesale High Strength Hgh Human Growth Hormone Hygetropin Kept In Dry Place from china suppliers

    Brand Name:SR

    Model Number:CAS 846-46-0

    Place of Origin:China

    ...HGH Human Growth Hormone HCG HMG Increase Muscle HGH wholesale Hygetropin 1)Details Description : Product Name HGH CAS NO CAS106505-90-2 Apperance Lyophilized powder Delivery time Within 2 days after received payment Minimum ...

    Shandong Shengri Chemical Co., Ltd.
    Verified Supplier

    Shandong

    Wholesale Human Growth Hormone Jintropin  jintropin (10IU/vial,10vials/kit) Hygetropin hgh Human Growth Hormone from china suppliers

    Brand Name:CR

    Model Number:jintropin ,hygetropin ,Igtropin ,HCG

    Place of Origin:China

    ...Human Growth Hormone Jintropin jintropin (10IU/vial,10vials/kit) Hygetropin hgh Human Growth Hormone Details : Product Name HGH ,hgh ,human growth hormone Other Name jintropin ,igtropin ,Hygetropin ,hgh hcg Color Fine white color Apperance lyophilized ...

    Shandong Chuangrui Chemical Technology Co., Ltd.
    Verified Supplier

    Shandong

    Wholesale 8iu / 10iu Natural HGH Human Growth Hormone Supplements Steroid Hormones from china suppliers

    Brand Name:Holybiological

    Model Number:CAS NO.: 96827-07-5

    Place of Origin:China

    ... Human Growth Hormone Supplements Steroid Hormones Product Name:Human Growth Hormon Hygetropin Purity (HPLC): 99.2%. Hygetropin Appearance:White Powder Hygetropin Grade : Pharmaceutical Grade Keywords : Bodybuilding;Human Growth Hormone;Hygetropin;HGH...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale HGH Fragment Pure Research Chemicals CAS 176-191 Hgh Human Growth Hormone Steroid from china suppliers

    Brand Name:HGH Fragment 176-191

    ...High Purity HGH Fragment 176-191 Hgh Human Growth Hormone Pharmaceutical Intermediates Superiority Skype: live:leercsupplier Skype name:RC supplier Email : rcbossboy@gmail.com Whatsapp :+...

    Hubei KUKE Chemcial Co., Ltd
    Verified Supplier

    Hubei

    Wholesale 100iu Jintropin HGH Human Growth Hormone Kigtropin Original HGH for Muscle Building from china suppliers

    Brand Name:Holybiological

    Model Number:WhatsApp:+8613545014917

    Place of Origin:China

    ...Jintropin HGH Human Growth Hormone Kigtropin Original HGH for Muscle Building What's the Jintropin? Jintropin is one of the most potent recombinant Human Growth Hormones on the market today. Jintropin stimulates linear cell growth and increases growth rate...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Taitropin HGH Human Growth Hormone Peptide Legit Bodybuilding Muscle Enhancement For Men from china suppliers

    Brand Name:bodybiological

    Model Number:Taitropin HGH

    Place of Origin:Hubei, China

    ...Legit Bodybuilding Muscle Enhancement Taitropin HGH Human Growth Hormone Peptide for Men Basic Information: We can give you: 1. Best quality in your requirement 2. Competitive ...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale MT2 MT1 Legit Hgh Human Growth Hormone Is Bodybuilding Healthy from china suppliers

    Brand Name:Human Growth Hormone

    Model Number:Mt2 (MT1)

    Place of Origin:China

    ...Bodybuilding Healthy Most Powerful Mt2 (MT1) (MT2) Hunman Growth Hormone Legit MT2 Hgh Human Growth Hormone Note – orders of 200 IU and higher are being sent in both 200 IU and ...

    Global chemicals Co.,Ltd
    Verified Supplier

    Wholesale Steroids HGH Human Growth Hormone / Male Growth Hormone Supplements from china suppliers

    Brand Name:Diselbiotech

    Model Number:Ghrp 2

    Place of Origin:China

    ... pituitary gland to release growth hormone with a slight stimulator effect on Prolactin, ACTH and Cortisol levels. GHRP-2 is a true hgh secretagogue, which it stimulates the body’s own secretion of hgh. Human Growth Hormone has been researched in...

    Wuhan Disel Biotechnology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale 99.8% Purity Jitropin HGH Human Growth Hormone Injections 10iu For Weight Loss from china suppliers

    Brand Name:HGH Human Growth Hormone

    Place of Origin:China

    ...99.8% Purity Jitropin HGH Human Growth Steroids Hormone Powder 10iu for Weight Loss Introduction Human Growth Steroid Hormone is not only one of the most beneficial hormones our body produces, but one of the most sought after in...

    Zhuhai jiacheng Sci. & Tech. Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale Bodybuilding Labeled Strongtropin HGH Human Growth Hormone For Bodybuilding Functions 12629 01 5 from china suppliers

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Real Somatropin R-HGH Human Growth Hormone 191AA HGH 10iu Blue Caps No label from china suppliers

    Brand Name:HongxiPharm

    Model Number:Somatropin / HGH 10iu/vial

    Place of Origin:CHINA

    ...Somatropin (Human Growth Hormone) R-HGH Product Name Somatropin Also known as 191AA HGH, Human Growth Hormone, R-HGH Appearance Sterile Filtered White lyophilized (freeze-dried) powder Standard Pharmaceutical / Research Use Packing 10iu / Bottle , ...

    Hongxi International Pharmaceutical Co., Ltd.
    Verified Supplier

    Hongkong

    Wholesale Human Growth Hormone Jintropin  jintropin (10IU/vial,10vials/kit) hgh Human Growth Hormone from china suppliers

    Brand Name:HY

    Model Number:CAS 12629015

    Place of Origin:China

    ...Human Growth Hormone Jintropin jintropin (10IU/vial,10vials/kit) hgh Human Growth Hormone Details : Product Name HGH ,hgh ,human growth hormone Other Name Hygetropin ,Igtropin,HGH ,jintropin Color Fine white color Apperance powder Delivery time Within 2 ...

    Hongyu Chemical Co.,Ltd.
    Verified Supplier

    Hubei

    Wholesale Jintropin HGH Human Growth Hormone Supplements 100iu/Box For Bodybuilder from china suppliers

    Brand Name:Pharma Grade

    Model Number:100iu

    Place of Origin:Zhejiang,China

    ...HGH human growth hormone, Gensci Jintropin Hgh 100iu/box for bodybuilders Quick details: Product name:jintropin hgh Other names:jintropin hgh/hgh/191aa,Genesci hgh,somatropin Specification:10iu/vial,100iu/kit Appearance;white powder Purity:99% MOQ:1 KIT ...

    HONGKONG RONGXIN BIO-TECH CO.,LTD
    Verified Supplier

    Shaanxi

    Wholesale Muscle Building HGH Human Growth Hormone Peptide 10iu for Get Taller / Gain Muscle from china suppliers

    Brand Name:YIHAN

    Model Number:Riptropin,Jintropin,Kigtropin,Taitropin,Getropin

    Place of Origin:China

    ... Supplements HGH Human Growth Hormone Riptropin for Get Taller / Gain Muscle Jin-Kig-Tai-Getropin Quick Details: Product name: Recombinant Human Interferon alpha 2b for injection Trade name: Riptropin Composition in effect: Recombinant Human Interferon...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale White Lyophilized Powder HGH Human Growth Hormone 12629-01-5 For Weight Loss from china suppliers

    Brand Name:Rund

    Model Number:HGH 12629-01-5

    Place of Origin:China

    ...HGH Human Growth Hormone 12629-01-5 Recombinant Human Interferon Supplements body building Quick Details: Generic name: Recombinant Human Interferon alpha 2b for injection Composition in effect: Recombinant Human Interferon alpha 2b. Usage: To get taller ...

    3M Biotech Co., Ltd
    Verified Supplier

    Wholesale High Pure Sermorelin Growth Hormone , Hgh Human Growth Hormone MOQ 50 Vials from china suppliers

    Brand Name:TY-Chemical

    Model Number:121062-08-6

    Place of Origin:China

    ...Sermorelin Human Growth Hormone Peptide Sermorelin Acetate High Pure MOQ 50vials Do you want yo know? Q: Can I use the ...

    Guangzhou Teng yue Chemical Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale Top Quality HGH human growth hormone HGH 191aa  Muscle growth from china suppliers

    Brand Name:HGH human growth hormone

    Model Number:H-9823

    Place of Origin:China

    ...Top Quality HGH human growth hormone HGH 191aa Muscle growth Product Name: HGH Other Name Somatropin/HGH Fragment 176-191 CAS: 12629-01-5 MF: C990H1528N262O3087w7 MW: 22124.12 Purity: 99% Shelf Life 2 ...

    Ali Healthcare Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale Recombinant HGH Human Growth Hormone Injections Bodybuilding 10 IU High Purity from china suppliers

    Brand Name:STRONGTROPIN

    Model Number:10 IU/vial

    Place of Origin:China

    ...Recombinant HGH Human Growth Hormone Injections Bodybuilding 10 IU High Purity Notice: STRONGTROPIN HGH is the genuine HGH with the best quality, 10 IU/vial. But there are some fake STRONGTROPIN HGHs in the market now. This...

    Hongkong Kangdisen Medical Co., Limited
    Site Member

    Hong Kong

    Wholesale HGH Human Growth Hormone Supplements Humatrope Gettropin For Treating SGA & IUGR from china suppliers

    Brand Name:YIJING

    Model Number:HGH

    Place of Origin:SHANGHAI

    ...HGH Human Growth Hormone Supplements Humatrope Gettropin For Treating SGA & IUGR Quick Details: Product Name: Gettropin Purity: 97% Grade ...

    ShangHai ShuCan industrial co.. LTD
    Active Member

    Shanghai

    Inquiry Cart 0