Sign In | Join Free | My futurenowinc.com
futurenowinc.com
Products
Search by Category
Home >

Hgh Human Growth Hormone

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    hgh human growth hormone

    All hgh human growth hormone wholesalers & hgh human growth hormone manufacturers come from members. We doesn't provide hgh human growth hormone products or service, please contact them directly and verify their companies info carefully.

    Total 1570 products from hgh human growth hormone Manufactures & Suppliers
    Wholesale Big Muscle 100UI Jintropin HGH Human Growth Hormone Peptide for Slimming from china suppliers

    Brand Name:Jintropin HGH

    Model Number:Jintropin HGH

    Place of Origin:Hubei, China

    ... Muscle 100UI Jintropin HGH Human Growth Hormone Peptide for Slimming Quick Detail: Place of Origin: Hubei, China Brand Name: Jintropin HGH Specification: 100iu (10iu x 10 vials) Supply Ability: 880 kits/month Jintropin 191aa Human Growth Hormone kit for...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Increase HGH Human Growth Hormone Stimulators / Hgh Hormones Muscle Growth from china suppliers

    Brand Name:Diselbiotech

    Model Number:Ghrp 6

    Place of Origin:China

    ... metabolism. It is most commonly used for treatment of Growth Hormone (GH) deficiencies, eating disorders, obesity, etc. Research has shown that use of these HGH Peptides increases lean muscle mass, strength, stamina and...

    Wuhan Disel Biotechnology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Jintropin HGH Human Growth Hormone Supplements 100iu/Box For Bodybuilder from china suppliers

    Brand Name:Pharma Grade

    Model Number:100iu

    Place of Origin:Zhejiang,China

    ...HGH human growth hormone, Gensci Jintropin Hgh 100iu/box for bodybuilders Quick details: Product name:jintropin hgh Other names:jintropin hgh/hgh/191aa,Genesci hgh,somatropin Specification:10iu/vial,100iu/kit Appearance;white powder Purity:99% MOQ:1 KIT ...

    HONGKONG RONGXIN BIO-TECH CO.,LTD
    Verified Supplier

    Shaanxi

    Wholesale Blue Top HGH Human Growth Hormone Supplements HGH for Green Top, 10iu/vial 10vials/kit from china suppliers

    Brand Name:Holybiological

    Model Number:CAS NO.:96827-07-5

    Place of Origin:China

    ...Blue Top HGH Human Growth Hormone Supplements HGH for Green Top, 10iu/vial 10vials/kit Product Details: HGH(blue top/green top/red top/yellow top) 10iu/vial, 10vials/kit CAS: 96827-07-5 ...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale ISO9001 HGH Human Growth Hormone Supplements Getropin HGH Bodybuilding For Men from china suppliers

    Brand Name:Holybiological

    Model Number:CAS NO.:96827-07-5

    Place of Origin:China

    ...HGH Injection Human Growth Hormone Supplements Getropin HGH Bodybuilding for Men Product Details: HGH Getropin 10iu/vial, 10vials/kit CAS: 96827-07-5 Appearance: White Freeze dried Powder Restful sleep (...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale CAS No 12629-01-5 Top Pure HGH Human Growth Hormone  Anti Aging Growth Hormone from china suppliers

    Brand Name:SGH

    Model Number:CAS No: 12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 15iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale PT 141 Bremelanotide 10mg Human Growth Hormone Peptide , HGH Human Growth Hormone Powder from china suppliers

    Brand Name:YIHAN

    Model Number:PT-141 (Brmelanotice)

    Place of Origin:China

    ...PT 141 Bremelanotide 10mg Human Growth Hormone Peptide , HGH Human Growth Hormone Powder COA: Appearance White to off white powder Consistent Purity(HPLC) ≥98% 98.80% Water <6.0% 5....

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale HGH Human Growth Hormone Medicine Grade For Adult Mucle Mass 10iu from china suppliers

    Brand Name:YIHAN

    Model Number:12629-01-5

    Place of Origin:China

    ...Buy Human Growth Hormone HGH Somatropin Cartridge 10iu for Mucle Building​ Our advantage: 1. We have experience in exporting steroids, as ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Wholesale Real Somatropin R-HGH Human Growth Hormone 191AA HGH 10iu Blue Caps No label from china suppliers

    Brand Name:HongxiPharm

    Model Number:Somatropin / HGH 10iu/vial

    Place of Origin:CHINA

    ...Somatropin (Human Growth Hormone) R-HGH Product Name Somatropin Also known as 191AA HGH, Human Growth Hormone, R-HGH Appearance Sterile Filtered White lyophilized (freeze-dried) powder Standard Pharmaceutical / Research Use Packing 10iu / Bottle , ...

    Hongxi International Pharmaceutical Co., Ltd.
    Verified Supplier

    Hongkong

    Wholesale hygetropin Human Growth Hormone red top hgh jintropin kigtropin hgh Human Growth Hormone from china suppliers

    Brand Name:hygetropin Human Growth Hormone red top hgh jintropin kigtropin hgh Human Growth Hormone

    Model Number:hygetropin Human Growth Hormone red top hgh jintropin kigtropin hgh Human Growth Hormone

    Place of Origin:hongkong

    ...hygetropin Human Growth Hormone red top hgh jintropin kigtropin hgh Human Growth Hormone HGH, Human Growth Hormone 191 amino acids 10iu/vial, 10vials/kit we have blue top, green top, red top, ...

    Green healthy living international co., LTD
    Verified Supplier

    Hongkong

    Wholesale HGH Human Growth Hormone 191aa For Muscle Building 2 Years Shelf Life from china suppliers

    Brand Name:HGH human growth hormone

    Model Number:H-9823

    Place of Origin:China

    ...Top Quality HGH human growth hormone HGH 191aa Muscle growth Product Name: HGH Other Name Somatropin/HGH Fragment 176-191 CAS: 12629-01-5 MF: C990H1528N262O3087w7 MW: 22124.12 Purity: 99% Shelf Life 2 ...

    Ali Healthcare Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale Healthy HGH Human Growth Hormone CAS 10418-03-8 Winstrol Stanozolol Powder from china suppliers

    Brand Name:Rund

    Model Number:10418-03-8

    Place of Origin:China

    ...Healthy Body Growth CAS 10418-03-8 Raw Steroid Powders Bulking Cycle Steroids Winstrol Stanozolol Quick Details: Product Name: ...

    3M Biotech Co., Ltd
    Verified Supplier

    Wholesale Selank 5mg / ml  Anxiolytic HGH Human Growth Hormone Peptides 129954-34-3 from china suppliers

    Brand Name:saichuang

    Model Number:peptides

    Place of Origin:China

    ...Selank 5mg / ml Anxiolytic HGH Human Growth Hormone Peptides 129954-34-3 Product Details Selank Product Details: Alias: Selanc : 129954-34-3 Sequence: Thr-Lys-...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Recombinant HGH Human Growth Hormone Injections Bodybuilding 10 IU High Purity from china suppliers

    Brand Name:STRONGTROPIN

    Model Number:10 IU/vial

    Place of Origin:China

    ...Recombinant HGH Human Growth Hormone Injections Bodybuilding 10 IU High Purity Notice: STRONGTROPIN HGH is the genuine HGH with the best quality, 10 IU/vial. But there are some fake STRONGTROPIN HGHs in the market now. This...

    Hongkong Kangdisen Medical Co., Limited
    Site Member

    Hong Kong

    Wholesale HGH Human Growth Hormone Supplements Humatrope Gettropin For Treating SGA & IUGR from china suppliers

    Brand Name:YIJING

    Model Number:HGH

    Place of Origin:SHANGHAI

    ...HGH Human Growth Hormone Supplements Humatrope Gettropin For Treating SGA & IUGR Quick Details: Product Name: Gettropin Purity: 97% Grade ...

    ShangHai ShuCan industrial co.. LTD
    Active Member

    Shanghai

    Wholesale The latest sales in 2016 HGH Human Growth Hormone 99% powder or liquid from china suppliers

    Brand Name:SHUCAN

    Model Number:·

    Place of Origin:SHANGHAI

    ...Human Growth Hormone HGH for Bodybuilding and Weight Loss [According to the requirements make powder or liquid ] Description: HGH is Human Growth Hormone, a natural hormone produced in the pituitary gland of the brain. HGH is considered "the key" hormone ...

    ShangHai ShuCan Industrial Co,LTD
    Active Member

    Wholesale Hygetropin 200iu  China HGH Human Growth Hormone from china suppliers

    Brand Name:Hygetropin

    Model Number:Hygetropin 8 iu / vial , 200 iu / kit

    Place of Origin:china

    .... In humans it is produced in the hypophysis and released if there are the right stimuli (e.g. training, sleep, stress, low blood sugar level). It is now important to understand that the freed HGH (human growth hormones...

    Hanz Pharmaceutical Co.,Ltd
    Active Member

    Wholesale Getropin 100IU HGH Human Growth Hormone Injections White Powder from china suppliers

    Brand Name:Getropin

    Model Number:100IU

    Place of Origin:China

    ... of osteoporosis Getropin Applications: Body building Anti-aging Fat loss Get taller Specifications: Brand Name: human growth hormones Place of Origin: China Color : white Lyophilized powder Standard: 10iu/vial, 100iu/box Competitive Advantage...

    TEIL TRADE CO.,LIMITED
    Site Member

    Guangdong

    Wholesale Natural Bodybuilding / Anti - Aging Natural HGH Human Growth Hormone HCG 5000iu from china suppliers

    Brand Name:HCG

    Model Number:HCG

    Place of Origin:China

    ...Natural Bodybuilding / Anti - Aging Natural HGH Human Growth Hormone HCG 5000iu Our company offers the most authentic GHRP products. If you are still hesitant ...

    HongKong Amgen Biopharm CO.,LTD
    Active Member

    Hong Kong

    Inquiry Cart 0