Sign In | Join Free | My futurenowinc.com
futurenowinc.com
Products
Search by Category
Home > Chemicals > Pharmaceuticals > Endocrine System Agents >

Human Growth Hormone Releaser

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    human growth hormone releaser

    All human growth hormone releaser wholesalers & human growth hormone releaser manufacturers come from members. We doesn't provide human growth hormone releaser products or service, please contact them directly and verify their companies info carefully.

    Total 2689 products from human growth hormone releaser Manufactures & Suppliers
    Wholesale PT-141 10mg Anti Aging Human Growth Hormone Releasing Peptides Freeze Dried Powder from china suppliers

    Brand Name:YIHAN

    Model Number:PT-141

    Place of Origin:China

    ...PT-141 10mg Anti Aging Human Growth Hormone Releasing Peptides Freeze Dried Powder 1. Buy Growth Hormone Peptides here! HGH 176-191 2mg/vial 10vials/kit 1g/bag GHRP-2 5mg/vial 10vials/...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale Selank Delta Sleep Human Growth Hormone Releasing Cas 129954-34-3 from china suppliers

    Brand Name:Selank

    Model Number:Selank 5mg*10vials

    Place of Origin:China

    ...Selank 2mg*10vials white powder Delta sleep Human growth peptides Human Growth Hormone Releasing Selank 5mg*10vials Name Selank Alias Selanc Cas 129954-34-3 M. F C33H57N11O9 Molecular Weight 751.9 Purity ...

    HONGKONG RONGXIN BIO-TECH CO.,LTD
    Verified Supplier

    Shaanxi

    Wholesale Jin / Hy / Kig Original 191aa HGH Human Growth Hormone For Growing Taller from china suppliers

    Brand Name:Bodybiological

    Model Number:CAS: 148031-34-9

    Place of Origin:Hubei, China

    ... HGH Human Growth Hormone For Growing Taller Human Growth Hormone, commonly known as HGH is a protein based peptide hormone of incredible anabolic properties and functions found in all human beings and essential for a host of functions within the human...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Supply Human Growth Hormone Peptide For Weight Loss Sermorelin CAS 86168-78-7 from china suppliers

    Brand Name:YIHAN

    Model Number:86168-78-7

    Place of Origin:China

    ...Supply Human Growth Hormone Peptide For Weight Loss Sermorelin CAS 86168-78-7 Basic Information: Product name: Sermorelin CAS: 86168-...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Wholesale Polypeptide Recombinant Human Growth Hormone Sermorelin for Increase Lean Body Mass from china suppliers

    Brand Name:Keray

    Model Number:86168-78-7

    Place of Origin:China

    1. Quick Detail: Sermorelin 2mg (GRF 1-29) Peptide Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168...

    Shenzhen Keray Biotech Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale Sermorelin Peptides Injectable 86168-78-7 Human Growth Hormone Releasing Peptides from china suppliers

    Brand Name:Hongkong SaiChuang

    Model Number:86168-78-7

    Place of Origin:China

    Sermorelin Peptides for Muscle Gaining Injectable 86168-78-7 Sermorelin No.: 86168-78-7 Molecular Formula: C149H246N44O42S Molecular Weight: 3357.96 Purity (HPLC): 99.0%min. Single Impurity (HPLC): 1.0%max Amino Acid Composition: ± 10% of theoretical ...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Steroids HGH Human Growth Hormone / Male Growth Hormone Supplements from china suppliers

    Brand Name:Diselbiotech

    Model Number:Ghrp 2

    Place of Origin:China

    ... pituitary gland to release growth hormone with a slight stimulator effect on Prolactin, ACTH and Cortisol levels. GHRP-2 is a true hgh secretagogue, which it stimulates the body’s own secretion of hgh. Human Growth Hormone has been researched...

    Wuhan Disel Biotechnology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Human Growth Hormone Supplements 10iu/vial,10vials / kit  Freezed Powder in White from china suppliers

    Brand Name:Holybiological

    Model Number:CAS: 96827-07-5

    Place of Origin:China

    ...Human Growth Hormone Supplements 10iu/vial,10vials / kit Freezed Powder in White Quick details: HGH Getropin 10iu/vial, ...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale GenSci Jintropin 10IU Human Growth Hormone for Muscle Growth from china suppliers

    Brand Name:Mkingbio

    Model Number:Jintropin

    Place of Origin:China

    ...GenSci Jintropin 10IU Human Growth Hormone for Muscle Growth Steroids Notification: Before buying and using steroids it is very important to know the exact ...

    Hubei Mking Biotech Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Lyophilized Powder Human Growth Hormone Supplements Freezed Powder In White from china suppliers

    Brand Name:Holybiological

    Model Number:CAS: 96827-07-5

    Place of Origin:China

    ...Human Growth Hormone Supplements 10iu/vial,10vials / kit Freezed Powder in White Quick details: HGH Getropin 10iu/vial, ...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale 99% Top Quality Sermorelin Peptides Injectable 86168-78-7 Human Growth Hormone Releasing Peptides from china suppliers

    Brand Name:TINGYI

    Model Number:CAS: 86168-78-7

    Place of Origin:CHINA

    Product Name: Sermorelin Product details: Sermorelin No.: 86168-78-7 Molecular Formula: C149H246N44O42S Molecular Weight: 3357.96 Purity (HPLC): 99.0%min. Single Impurity (HPLC): 1.0%max Amino Acid Composition: ± 10% of theoretical Peptide Content (N%): ...

    Chongqing Tingyi Biotechnology Co.,Ltd
    Verified Supplier

    Chongqing

    Wholesale 99.9% Purity Human Growth Hormone Peptide GHRP 6 5mg CAS 87616-84-0 from china suppliers

    Brand Name:Hongxi Pharm

    Model Number:Hormone Peptide

    Place of Origin:HongKong

    ...Human Growth Hormmone Polypeptide GHRP6 GHRP-6 5mg / vial GHRP-6 Peptide Details: Product Name: GHRP-6 Synonyms: GHRP-6 CAS ...

    Hongxi International Pharmaceutical Co., Ltd.
    Verified Supplier

    Hongkong

    Wholesale Modified Anabolic Androgenic Steroids CJC1295 Human Growth Hormone Peptide without DAC 863288-34-0 from china suppliers

    Brand Name:Saichuang

    Model Number:863288-34-0

    Place of Origin:Wuhan,Hubei

    ... gland to stimulate the release of Human Growth Hormone. CJC-1295 without DAC could be referred to more properly as a second generation derivative of GHRH. GHRH is modified to create what is known as Releasing

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Wholesale 99% High Purity Human Growth Hormone Oxytocin Acetate CAS 50-56-6 2mg/vial peptide from china suppliers

    Brand Name:Top Pharm

    Model Number:50-56-6

    Place of Origin:China

    99% purit Oxytocin AcetateCAS number:50-56-6white powder Peptide series Product Name Oxytocin Acetate Sequence Cas No. 50-56-6 Molecular Formula C43H66N12O12S2 Molecular Weight 1007.2 Purity (HPLC) 98.0%min. Appearance? White powder Single Impurity(HPLC)?...

    TOP PHARM CO.,LIMITED
    Verified Supplier

    Wholesale 99% Purity Nature Fat Loss and Anti Aging Polypeptide Hormones Ghrp-2 Growth Hormone Releasing Peptide Ghrp-2 from china suppliers

    Brand Name:HBU

    Model Number:158861-67-7

    Place of Origin:CHINA

    ... Polypeptide Hormones Ghrp-2 GHRP-2 (Growth Hormone Releasing Peptide) CAS: 158861-67-7 Molecular Formula: C45H55N9O6 Molecular Weight: 818.0 Appearance:White Powder Package: 5 mg/vial,10mg/vial,10vials/kit Description Growth hormone releasing peptides...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Wholesale High Pure Sermorelin Growth Hormone , Hgh Human Growth Hormone MOQ 50 Vials from china suppliers

    Brand Name:TY-Chemical

    Model Number:121062-08-6

    Place of Origin:China

    ...Sermorelin Human Growth Hormone Peptide Sermorelin Acetate High Pure MOQ 50vials Do you want yo know? Q: Can I use the ...

    Guangzhou Teng yue Chemical Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation from china suppliers

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Muscle Building Human Growth Hormone Steroids GHRP-6 Peptide CAS 87616-84-0 from china suppliers

    Brand Name:KANGDISEN

    Model Number:5 mg/vial

    Place of Origin:China

    ... Human Growth Hormone Steroids GHRP-6 Peptide CAS 87616-84-0 GHRP-6 GHRP-6 is a potent stimulator of natural Growth Hormone release. GHRP-6 is a Hexa-peptide that promotes food intake by stimulating hunger and helps increase energy metabolism. Growth...

    Hongkong Kangdisen Medical Co., Limited
    Site Member

    Hong Kong

    Wholesale Kigtropin Human Growth Hormone Bodybuilding Supplements Keep Youth Anti-age Steroids HGH from china suppliers

    Place of Origin:Shen Zhen of China

    Brand Name:kintropin

    Model Number:Whf@hkhanwei.com

    ... increase your levels of human growth hormone and it would promote bone and muscle growth. With age growth, the body's own growth hormone secretion decreased by 70%.You get all the benefits of a strong, clinically backed HGH releaser

    Hongkong HW Biotech Co.,Ltd.
    Site Member

    Yunnan

    Inquiry Cart 0