Sign In | Join Free | My
Search by Category
Home >

Human Growth Hormons

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type


    human growth hormons

    All human growth hormons wholesalers & human growth hormons manufacturers come from members. We doesn't provide human growth hormons products or service, please contact them directly and verify their companies info carefully.

    Total 11797 products from human growth hormons Manufactures & Suppliers
    Wholesale Big Muscle 100UI Jintropin HGH Human Growth Hormone Peptide for Slimming from china suppliers

    Brand Name:Jintropin HGH

    Model Number:Jintropin HGH

    Place of Origin:Hubei, China

    ... Jintropin HGH Human Growth Hormone Peptide for Slimming Quick Detail: Place of Origin: Hubei, China Brand Name: Jintropin HGH Specification: 100iu (10iu x 10 vials) Supply Ability: 880 kits/month Jintropin 191aa Human Growth Hormone kit for...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier


    Wholesale Hexarelin Human Growth Hormone Peptide from china suppliers

    Brand Name:YIHAN

    Model Number:Hexarelin

    Place of Origin:China

    ...Hexarelin Human Growth Hormone Peptide Lyophilized inject for Muscle Building Detailed Product Description Product Name: Hexarelin Appearance: Lyophilized powder ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier


    Wholesale CAS 221231-10-3 Human Growth Hormone Peptide Somatropin Injection 2iu / Vial from china suppliers

    Brand Name:YIHAN

    Model Number:hgh pen

    Place of Origin:CHINA

    ...High quality bodybuilding Somatropin Cartridges Somatropin injection Human Growth Hormone HGH pen 2iu/vial,10vial/kit Product Description Frag 176-191 Synonyms: Fragment 177-191, ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier


    Wholesale 8iu /10iu  Natural Human Growth Hormone Supplements Steroid Hormones from china suppliers

    Brand Name:Holybiological

    Model Number:CAS NO.: 96827-07-5

    Place of Origin:China

    ... Natural Human Growth Hormone Supplements Steroid Hormones Product Name:Human Growth Hormon Hygetropin Purity (HPLC): 99.2%. Hygetropin Appearance:White Powder Hygetropin Grade : Pharmaceutical Grade Keywords : Bodybuilding;Human Growth Hormone;Hygetropin...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier


    Wholesale Steroids HGH Human Growth Hormone / Male Growth Hormone Supplements from china suppliers

    Brand Name:Diselbiotech

    Model Number:Ghrp 2

    Place of Origin:China

    ... gland to release growth hormone with a slight stimulator effect on Prolactin, ACTH and Cortisol levels. GHRP-2 is a true hgh secretagogue, which it stimulates the body’s own secretion of hgh. Human Growth Hormone has been researched...

    Wuhan Disel Biotechnology Co., Ltd.
    Verified Supplier


    Wholesale Anti Aging Human Growth Hormone Hygetropin HGH 100iu/Box CAS 96827-07-5 from china suppliers

    Brand Name:Pharma Grade

    Model Number:100iu

    Place of Origin:Zhejiang,China

    ...) Company:Rongxin Bio-Tech Co.,ltd Description: Riptropin [rDNA origin] is a way to supply natural growth human growth hormone for people who may deficient or may

    Verified Supplier


    Wholesale 8iu / 10iu Natural HGH Human Growth Hormone Supplements Steroid Hormones from china suppliers

    Brand Name:Holybiological

    Model Number:CAS NO.: 96827-07-5

    Place of Origin:China

    ... Natural Human Growth Hormone Supplements Steroid Hormones Product Name:Human Growth Hormon Hygetropin Purity (HPLC): 99.2%. Hygetropin Appearance:White Powder Hygetropin Grade : Pharmaceutical Grade Keywords : Bodybuilding;Human Growth Hormone;Hygetropin...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier


    Wholesale GenSci Jintropin 10IU Human Growth Hormone for Muscle Growth from china suppliers

    Brand Name:Mkingbio

    Model Number:Jintropin

    Place of Origin:China

    ...GenSci Jintropin 10IU Human Growth Hormone for Muscle Growth Steroids Notification: Before buying and using steroids it is very important to know the exact ...

    Hubei Mking Biotech Co., Ltd.
    Verified Supplier


    Wholesale Melanotan II Polypeptide Hormones CAS 121062-08-6 Melanotan 2 Human Growth Hormone MT-2 For Skin Tanning from china suppliers

    Brand Name:YuanCheng

    ...High Quality Melanotan II Polypeptide Hormones CAS 121062-08-6 Melanotan 2 Human Growth Hormone MT-2 For Skin Tanning Quick Detail: Unit Size :10 mg/vial Unit Quantity :1 Vial CAS ...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier


    Wholesale 99 Purity IGF-1LR3 Peptide Legal Human Growth Hormone For Fat Loss & Muscle Building from china suppliers

    Brand Name:TY-Chemical

    Model Number:946870-92-4

    Place of Origin:China

    ...IGF-1LR3 Human Growth Hormone 99 Purity Peptides for Fat Loss & Muscle Building Key Words : IGF -1LR3 IGF- 1 DES IGF-...

    Guangzhou Teng yue Chemical Co., Ltd.
    Verified Supplier


    Wholesale White Lyophilized Powder HGH Human Growth Hormone 12629-01-5 For Weight Loss from china suppliers

    Brand Name:Rund

    Model Number:HGH 12629-01-5

    Place of Origin:China

    ...HGH Human Growth Hormone 12629-01-5 Recombinant Human Interferon Supplements body building Quick Details: Generic name: Recombinant Human Interferon alpha 2b for injection Composition in effect: Recombinant Human Interferon alpha 2b. Usage: To get taller ...

    3M Biotech Co., Ltd
    Verified Supplier

    Wholesale 99.9% Purity Human Growth Hormone Peptide GHRP 6 5mg CAS 87616-84-0 from china suppliers

    Brand Name:Hongxi Pharm

    Model Number:Hormone Peptide

    Place of Origin:HongKong

    ...Human Growth Hormmone Polypeptide GHRP6 GHRP-6 5mg / vial GHRP-6 Peptide Details: Product Name: GHRP-6 Synonyms: GHRP-6 CAS ...

    Hongxi International Pharmaceutical Co., Ltd.
    Verified Supplier


    Wholesale Ghrp2 Human Growth Hormone CAS 158861-67-7 Pralmorelin GHRP-2 White Powder from china suppliers

    Brand Name:Yuan Cheng

    Model Number:CAS 158861-67-7

    Place of Origin:China

    ...Ghrp2 Hormone Human Growth CAS 158861-67-7 Pralmorelin GHRP-2 Product Name:GHRP-2 (Pralmorelin),Growth Hormone Releasing Peptide-2 CAS: 158861-67-7 Molecular Formula: C42H50N8O5 Molecular Weight: 746.90 Purity (HPLC): 98.0%...

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier


    Wholesale High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation from china suppliers

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier


    Wholesale Human Growth Hormone HGH Polypeptide Steroids HGH 176-191 2mg for Muscle Building from china suppliers

    Brand Name:Keray

    Model Number:HGH 176-191

    Place of Origin:China

    1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial Synonyms :HGH FRAG 176-191,fragment 176 Molecular :Formula C78H125N23O23S2 Molecular Weight :1817.1 Sequence :H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH Appearance :...

    Shenzhen Keray Biotech Co., Ltd
    Verified Supplier


    Wholesale 12 IU HGH Injectable Human Growth Hormone Steroids Nordictropin from china suppliers

    Brand Name:Nordictropin

    Model Number:12 IU/vial

    Place of Origin:China

    ...12 IU HGH Injectable Human Growth Hormone Steroids Nordictropin We can supply Nordictropin 12 IU/val as the picture shows. The vial ...

    Hongkong Kangdisen Medical Co., Limited
    Site Member

    Hong Kong

    Wholesale Kigtropin Human Growth Hormone Bodybuilding Supplements Keep Youth Anti-age Steroids HGH from china suppliers

    Place of Origin:Shen Zhen of China

    Brand Name:kintropin


    ...,this products contain ingredients which increase your levels of human growth hormone and it would promote bone and muscle growth. With age growth, the body's own growth hormone secretion decreased by 70%.You get all the benefits...

    Hongkong HW Biotech Co.,Ltd.
    Site Member


    Wholesale Gensci Anti-aging HGH Natural Bodybuilding Supplements Human Growth Hormone Jintropin from china suppliers

    Brand Name:HongKong Blue

    Model Number:c

    Place of Origin:China

    ...-aging HGH Natural Bodybuilding Supplements Human Growth Hormone Jintropin Jintropin Human Growth Hormone: Jintropin was developed by Chinese scientist Dr. Lei Jin, who named it after himself. It is extremely a complicated hormone which includes 191 amino...

    HongKong Blue Universal Co., Limited.
    Active Member


    Inquiry Cart 0