Shipyard 33dB NRR Waterproof Noise Reduction Ear Plugs ANSI AS NZS
|
... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a...
JIAXING FUXING IMP. AND EXP. CO.,LTD
|
PU Plastic Soft Ear Plugs , Noise Reduction Ear Plugs Super Flexibility
|
Description The Noise Ear Plugs realize the function to reduce work, home, sleep and safety noise. Due to the washable and reusable design, it is really friendly to the environment. As a matter of fact, it can be an ideal facility used for airplanes, ......
CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
|
FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design
|
...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam for the best fit and low ontact pressure. 3. Good inner space for ear......
FUTURE TECH LIMITED
|
Soft Silicone Corded Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff
|
...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs......
Sweet Home International(H.K.)Limited
|
Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone
|
Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo plug 2. In ear type, Dual ear with MIC and refined MIC housing 3. high quality speaker, Hi-Fi sound quality 4. Stereo earphone with noise......
Earlisten Electronic Co ., Ltd
|
Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone
|
|
Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo plug 2. In ear type, Dual ear with MIC and refined MIC housing 3. high quality speaker, Hi-Fi sound quality 4. Stereo earphone with noise......
Earlisten Electronic Co ., Ltd
|
Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs
|
... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-......
Anhui Uniform Trading Co.Ltd
|
Multi Color Wired In Ear Earphones Flat Cable 1.2 MM Noise Cancelling Earbuds Factory
|
...Ear Earphones Wired Earphone Information Item Number 3404-FY148 Communication Wired Earphone Color Multi color Plug 3.5mm straight plug Cable Flat cable Flat Cable Specification Impedance 24Ω±5Ω Speaker size 10MM Cable length 120CM Frequency range 20Hz-20KHz Sensitivity 100dB±5dB Max power input 10mW Feature High quality sound insulation Passive noise reduction......
Guangzhou Huayi Electronic Factory
|
50mm Onikuma K8 Noise Cancelling Gaming Headphones
|
...Ear Headphones with Volume Control LED Light Cool Style Stereo Noise Reduction Earphone features: Compatibility: With 3. 5mm audio cable jack (USB jack just work for LED light), wired stereo sound over ear gaming headset supports PC, Xbox One Controller(has 3. 5mm plug......
Shenzhen Ouni Technology Co.,Ltd
|
Titanium Film Horn Noise Cancelling Microphone Earbuds
|
... deep bass sound Noise reduction function can be enabled in a variety of states, including Bluetooth on or off, plug-in state Soft protein memory foam ear pads with large ear cups provide comfortable wearing Metal stretchable arm, rotatable and foldable,...
Golden Promise Industrial Mfg.Co.,Ltd.
|
Submit your “shipyard 33db noise reduction ear plugs” inquiry in a minute :