60cm reusable noise cancelling ear plugs

Brand Name:Futuretech

Model Number:FTFE-02

Place of Origin:Shenzhen

... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded ear plugs in various colors including light blue, black, pink, green, orange and yellow, enough for your daily use; The cord is approx. 60 ...

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plastic material, which has the advantage of

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-...

Brand Name:Aonike

Model Number:BT880

Place of Origin:China

RGB Cute Cat Ears Bluetooth 5.0 Wireless Headphone With Microphone Noise Cancelling Girl Stereo Music Product Description Horn diameter 40mm 32 euro Sensitivity 108± 3dB Maximum power input 100mW Line length 2 m Plug 3.5 mm/USB Impedance Ω 2.2 K or less ...

Brand Name:OEM / ODM / HYQ

Model Number:SY1027

Place of Origin:China

...Ear Earphones 22Ω Durable Cord Wired Noise Cancelling Earbuds 3.5mm Wired Earphones In-Ear Headphone Colorful Earbuds Dynamic 10mm Speaker Earphone Prodctus​ Specification Style Number SY1027 Wire Material PVC Speaker Φ10MM Jack Type 3.5mm Cable Length 120cm Track System Stereo Frequency range 20Hz-20KHz Impedance 22Ω±5Ω Sensitivity 90dB±5dB Max power input 10mW Plug 3.5mm Plug...

Brand Name:onikuma

Model Number:k1b

Place of Origin:China

... Switch , PC , Nintendo 3DS , Laptop , PSP , Tablet , iPad , Computer , Mobile Phone . 【HD Crystal Stereo Surround & Noise Cancelling】- Perfectly reducing background noise by all-inclusive PU leather earmuffs to enjoy each 3D loud explosion and

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...Noise Cancelling Headphones High Elasticity Product description 1. Excellent sound quality,eco-friendly. 2. Foldable design,High-performance sound quality. 3. Quality Inspection before shipping to clients,We will supply 12 months warranty. 4. The jack plug is made of durable rubber that will withstand the wear and tear of daily listening. 5. High elastic sponge is made of the ear...

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...Noise Cancelling Headphones ABS / Plastic Material Cartoon Style Product description 1. 100% Brand new and high quality! 2. Soft and comfortable sleeping headband with built-in headphones 3. Headband can also be as a sleep mask as well 4. Plugs right into your iPod, MP3 Player, or capable smartphone 5. Headband can be washed after removing electronics 6. 1 YEAR LIMITED WARRANTY Specification Product Name Deep Bass Sound On-Ear

Brand Name:sweet

Model Number:HT-034

Place of Origin:Ningbo

...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs and wires can be separated Silicone material, washable reusable...

Brand Name:picun

Model Number:ANC-02

Place of Origin:Made in China

... deep bass sound Noise reduction function can be enabled in a variety of states, including Bluetooth on or off, plug-in state Soft protein memory foam ear pads with large ear cups provide comfortable wearing Metal stretchable arm, rotatable and foldable,

Brand Name:AKE

Model Number:D4

Place of Origin:CHINA

Earphone Eerbuds USB TYPE C Earpiece + Mic Volume Control For Xiao mi Huawei Mate 10 Mate 10 Pro P20 P20 Pro Style wholesale mobile type c plug in-ear earphone 120cm high quality wired type-c earbuds with mic and Volume Control logo customized for xiaomi/...

Brand Name:DL

Model Number:DL-G100Pro

Place of Origin:CHINA

7.1 Sound Headsets USB Plug Noise Canceling Easy Control With Microphone Features: ♫【Comfortable Ergonomically Desigh】 Big and soft over-ear pads provide excellent durability and long-time wearing comfy. The skin-friendly leather material of the ...

Brand Name:OEM

Model Number:OEM

Place of Origin:CHINA

...Noise Prevention Reusable Noise-Reducing Silicone Earplugs Product Description Advantage 1. Each pairs of earplugs is independent to store in a carry case,convenient carring and saving at anywhere 2. Reusable Ear plugs easy to distinguish and enough for all family or gift friends. 3. Soft TPR materials for unparalleled comfort: these noise...

Brand Name:Artshow

Model Number:AEP-6132

Place of Origin:China

Wired Earphones Ergonomic Wired Earphones In-Ear Earphone With Soft Silicon Earbuds With Microphone Black For Music And Computer Gaming Product Description Article No.: AEP-6132 Speaker Φ10mm Frequency Response 20hz-20khz Cable Length 1.2M Plug type Φ3.5mm...

Brand Name:Tianmingwei

Model Number:TCE02

Place of Origin:CHINA

Product Description Single Earphone with Microphone ,3.5mm Earbud One Side Metal Noise Isolating Earplugs, Spring Coil Reinforced Cord 1,This earphone has a 4-conductor plug and the built-in microphone makes this a headset earphone that is iPhone ...

Place of Origin:China

Brand Name:OEM/ODM

Model Number:MO-EE001

Detailed product specification: Style: Simple Type Earphone Materials: ABS Suit For: MP3/MP4/PC Communication: Wired Power Capability: 1000mw Color: White Specifications: Model MO-EE001 Speaker 15mm Sensitivity 102Db S.P.L at 1khz Impedance 32ohms ...

Brand Name:Cree

Model Number:EP0001

Place of Origin:China

Ear Cushions Ear Pads Foam Headphone Earpads Fit For Bose QC2 QC15 QC25 QC35 Essential details Communication: Wired Function: Noise Cancelling Style: In-ear Volume Control: No Waterproof Standard: IPX-4 Place of Origin: China Vocalism Principle: Other ...