Sign In | Join Free | My futurenowinc.com
futurenowinc.com
Products
Search by Category
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request

as 24db foam ear plugs

All as 24db foam ear plugs wholesalers & as 24db foam ear plugs manufacturers come from members. We doesn't provide as 24db foam ear plugs products or service, please contact them directly and verify their companies info carefully.

Total 18 products from as 24db foam ear plugs Manufactures & Suppliers
Wholesale AS 24db Foam Ear Plugs Soft Noise Reduction Reusable Earplugs For Sleeping from china suppliers

Brand Name:Futuretech

Model Number:FTFE-03

Place of Origin:Shenzhen

Safety Silicone Reusable Ear Plugs for personal hearing proctection Description of Reusable Ear plugs : Material The ear plugs are made of silicone, which is soft and comfortable to wear, the cord is made of nylon, which is strong and not easy to break dow...

FUTURE TECH LIMITED
Verified Supplier

Wholesale 38dB SNR 31dB NRR Noise Dampening Foam Ear Plugs 12*7*24mm from china suppliers

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

...Foam Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU Foam (Latex free and PVC free); Slow rebound foam material fits different ear canal structures and have no pressure on ear High Noise Reduction: 38dB SNR (Single Number Rating) and 31dB NRR (Noise Reduction Rating) - They are two different rating systems; High noise reduction rate ear plugs...

JIAXING FUXING IMP. AND EXP. CO.,LTD
Active Member

Zhejiang

Wholesale Pu foam Ear plugs,Earplugs,Foam ear plugs ,CE EN 352-2 Bullet PU Foam Ear plugs from china suppliers

Place of Origin:yangzhou

Brand Name:Xinfly

Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description for earplug with metal tube: - Earplugs: PU foam earplug or silicone earplug with cord or without cord - ...

YANGZHOU XINFLY AMENITIES CO.,LTD
Active Member

Jiangsu

Wholesale Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs from china suppliers

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

Wholesale Pu Foam Ear Plugs from china suppliers

Place of Origin:China

Brand Name:DISHINE

Pu Foam Ear Plugs 【Description】 Sound insulation is made of PU foam, which is easy to put into your ear to keep away the noise. Each pair is packed with a easy-open plastic case. Your logo can be added on the case. Several colors are available. Pricing...

Dishine International Limited
Active Member

Zhejiang

Wholesale Soft Silicone Corded Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff from china suppliers

Brand Name:sweet

Model Number:HT-034

Place of Origin:Ningbo

...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs...

Sweet Home International(H.K.)Limited
Active Member

Zhejiang

Wholesale PU Soft Ear Plugs For Sleeping , Disposable Foam Earplugs Orange Color from china suppliers

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

Description 100% PVC-Free, slow rebound, various rebound time are welcomed Our foam earplugs are made of extra-soft, lightweight foam that seals the ear canal without pressure, tensile, disposable Bullet shape for a snug fit while gently conforming to the ...

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

Wholesale Lightweight Memory Foam Eye Mask With Ear Plugs / Adjustable Strap from china suppliers

Brand Name:D-Jeesian

Model Number:H09-FEM19009

Place of Origin:GuangDong/China

1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work ★ ELIMINATE EYE FATIGUE: Unique contoured eliminate eye fatigue, which has ZERO pressure to eyes, promoting REM sleep. ...

Shenzhen D-Jeesian Bags Co., Ltd.
Active Member

Guangdong

Wholesale Fashion Memory Foam Night Eye Cover 3D Lint Free Eye Patch With Ear Plugs from china suppliers

Place of Origin:Guangdong, China

Model Number:XT-EY008

Hot Selling Comfortable Luxury Fashion Memory Foam Sleeping Covers 3D lint free eye patch with Ear Plugs Product Description eye mask Item: sleeping eye mask Material: 3D memory foam Size: 23*8.5cm or customized Color: Customized any color MOQ: 3000pcs ...

Shenzhen Xintaixin Packaging Products Co., Ltd.
Verified Supplier

Guangdong

Wholesale E-1013 Bullet Type Sound Proof Ear Plugs For Sleeping Soft Resilient Material from china suppliers

Brand Name:SAFEYEAR

Model Number:E-1013

Place of Origin:CHINA

E-1013 Bullet Type Earplug For Good Sleeping Soft Resilient Material * Use: Improve sleep, concentrate on the spirit, protect hearing, etc. * Place: Can be used in homes, dormitories, classrooms, construction sites, factories and other places. * Efficacy: ...

Shanghai Workplus Technology Co.,ltd
Active Member

Shanghai

Wholesale 50ohm Plug Clamp RF Coaxial Connectors N Male For 1 / 2 ″ Flexible  Feeder Cable from china suppliers

Brand Name:ZD

Model Number:ZD-CN-NM-CF12

Place of Origin:CHINA

...-16 Electrical Characteristic Impedance 50ohm Frequency Range DC-6GHz VSWR ≤1.10@DC-3000MHz Insertion Losss ≤0.24dB(6GHz) 3rd Order IM (PIM3) ≤ -155dBc@2×20W Working Vlotage 1000V RMS,50Hz,at

SHENZHEN ZD TECH CO., LTD
Verified Supplier

Guangdong

Wholesale Adult Medical Temperature Sensor Ear Canal Foam Skin Temperature Probe For VR 2Pin from china suppliers

Brand Name:Amydi-med or Customized

Model Number:AMD-DP-EC0007-X

Place of Origin:China

...Ear Canal Foam Skin Temperature Probe Skin Temperature Probe Quick Details: Product Name: Skin Temperature Probe Model no.: AMD-DP-EC0007-X Compatible brand : VR medical (thin)2.25K Plug: VR 2Pin Cable color: White cable Cable material: PVC, Probe material: Foam...

Shenzhen Amydi-Med Electronics Tech Co., Ltd.
Active Member

Guangdong

Wholesale 2x3.5 Plug Led Lights Gaming Headset , Xbox One Light Up Headset Wired from china suppliers

Brand Name:DL

Model Number:DL-G19

Place of Origin:CHINA

...Ear Headphone With Mic-Mute For PC Features: ♫【Humanized Design& Comfortable for Wearing】Easy to control the button of Mute and the flexible mic of the headset at any time without disturbing your gaming. Superior comfortable memory foam and good air permeability over-ear adjustable pads can reduce hearing impairment and heat sweat for long time wearing ♫【Fancy Led Light】Plug...

DL ELECTRONICS CO.,LTD
Active Member

Wholesale EM105 ABS Material Economic Safety Earmuff Essential for Industrial Noise Reduction from china suppliers

Place of Origin:Zhejiang, China

Brand Name:WELWORK

Model Number:EM105

...h high density foam filter Earmuff NRR 24db Size suit for adlut,easy to adjust Color Yellow,red,blue or others Function Reduce the noise to protect the ear MOQ 3000PCS Production capacity 100000pcs/month Packing one pc per polybag,50pcs per carton Terms of ...

Ningbo Welwork Ppe Co., Ltd.
Verified Supplier

Zhejiang

Wholesale Titanium Film Horn Noise Cancelling Microphone Earbuds from china suppliers

Brand Name:picun

Model Number:ANC-02

Place of Origin:Made in China

... deep bass sound Noise reduction function can be enabled in a variety of states, including Bluetooth on or off, plug-in state Soft protein memory foam ear pads with large ear cups provide comfortable wearing Metal stretchable arm, rotatable and foldable,

Golden Promise Industrial Mfg.Co.,Ltd.
Active Member

Inquiry Cart 0