| Sign In | Join Free | My futurenowinc.com |
|
All as 24db foam ear plugs wholesalers & as 24db foam ear plugs manufacturers come from members. We doesn't provide as 24db foam ear plugs products or service, please contact them directly and verify their companies info carefully.
| Total 18 products from as 24db foam ear plugs Manufactures & Suppliers |
|
|
|
Brand Name:Futuretech Model Number:FTFE-03 Place of Origin:Shenzhen Safety Silicone Reusable Ear Plugs for personal hearing proctection Description of Reusable Ear plugs : Material The ear plugs are made of silicone, which is soft and comfortable to wear, the cord is made of nylon, which is strong and not easy to break dow... |
FUTURE TECH LIMITED
|
|
|
Place of Origin:Zhejiang China Brand Name:FuXing Model Number:OEM ODM ...Foam Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU Foam (Latex free and PVC free); Slow rebound foam material fits different ear canal structures and have no pressure on ear High Noise Reduction: 38dB SNR (Single Number Rating) and 31dB NRR (Noise Reduction Rating) - They are two different rating systems; High noise reduction rate ear plugs... |
JIAXING FUXING IMP. AND EXP. CO.,LTD
Zhejiang |
|
|
Place of Origin:yangzhou Brand Name:Xinfly Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description for earplug with metal tube: - Earplugs: PU foam earplug or silicone earplug with cord or without cord - ... |
YANGZHOU XINFLY AMENITIES CO.,LTD
Jiangsu |
|
|
Brand Name:UNIFORM Model Number:AUTC-HP-M1152 Place of Origin:CHINA ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-... |
Anhui Uniform Trading Co.Ltd
Anhui |
|
|
Place of Origin:China Brand Name:DISHINE Pu Foam Ear Plugs 【Description】 Sound insulation is made of PU foam, which is easy to put into your ear to keep away the noise. Each pair is packed with a easy-open plastic case. Your logo can be added on the case. Several colors are available. Pricing... |
Dishine International Limited
Zhejiang |
|
|
Brand Name:sweet Model Number:HT-034 Place of Origin:Ningbo ...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs... |
Sweet Home International(H.K.)Limited
Zhejiang |
|
|
Place of Origin:Changzhou, Jiangsu Brand Name:Good Job Description 100% PVC-Free, slow rebound, various rebound time are welcomed Our foam earplugs are made of extra-soft, lightweight foam that seals the ear canal without pressure, tensile, disposable Bullet shape for a snug fit while gently conforming to the ... |
CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu |
|
|
Brand Name:D-Jeesian Model Number:H09-FEM19009 Place of Origin:GuangDong/China 1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work ★ ELIMINATE EYE FATIGUE: Unique contoured eliminate eye fatigue, which has ZERO pressure to eyes, promoting REM sleep. ... |
Shenzhen D-Jeesian Bags Co., Ltd.
Guangdong |
|
|
Place of Origin:Guangdong, China Model Number:XT-EY008 Hot Selling Comfortable Luxury Fashion Memory Foam Sleeping Covers 3D lint free eye patch with Ear Plugs Product Description eye mask Item: sleeping eye mask Material: 3D memory foam Size: 23*8.5cm or customized Color: Customized any color MOQ: 3000pcs ... |
Shenzhen Xintaixin Packaging Products Co., Ltd.
Guangdong |
|
|
Brand Name:SAFEYEAR Model Number:E-1013 Place of Origin:CHINA E-1013 Bullet Type Earplug For Good Sleeping Soft Resilient Material * Use: Improve sleep, concentrate on the spirit, protect hearing, etc. * Place: Can be used in homes, dormitories, classrooms, construction sites, factories and other places. * Efficacy: ... |
Shanghai Workplus Technology Co.,ltd
Shanghai |
|
|
Brand Name:ZD Model Number:ZD-CN-NM-CF12 Place of Origin:CHINA ...-16 Electrical Characteristic Impedance 50ohm Frequency Range DC-6GHz VSWR ≤1.10@DC-3000MHz Insertion Losss ≤0.24dB(6GHz) 3rd Order IM (PIM3) ≤ -155dBc@2×20W Working Vlotage 1000V RMS,50Hz,at |
SHENZHEN ZD TECH CO., LTD
Guangdong |
|
|
Brand Name:Amydi-med or Customized Model Number:AMD-DP-EC0007-X Place of Origin:China ...Ear Canal Foam Skin Temperature Probe Skin Temperature Probe Quick Details: Product Name: Skin Temperature Probe Model no.: AMD-DP-EC0007-X Compatible brand : VR medical (thin)2.25K Plug: VR 2Pin Cable color: White cable Cable material: PVC, Probe material: Foam... |
Shenzhen Amydi-Med Electronics Tech Co., Ltd.
Guangdong |
|
|
Brand Name:DL Model Number:DL-G19 Place of Origin:CHINA ...Ear Headphone With Mic-Mute For PC Features: ♫【Humanized Design& Comfortable for Wearing】Easy to control the button of Mute and the flexible mic of the headset at any time without disturbing your gaming. Superior comfortable memory foam and good air permeability over-ear adjustable pads can reduce hearing impairment and heat sweat for long time wearing ♫【Fancy Led Light】Plug... |
DL ELECTRONICS CO.,LTD
|
|
|
Place of Origin:Zhejiang, China Brand Name:WELWORK Model Number:EM105 ...h high density foam filter Earmuff NRR 24db Size suit for adlut,easy to adjust Color Yellow,red,blue or others Function Reduce the noise to protect the ear MOQ 3000PCS Production capacity 100000pcs/month Packing one pc per polybag,50pcs per carton Terms of ... |
Ningbo Welwork Ppe Co., Ltd.
Zhejiang |
|
|
Brand Name:picun Model Number:ANC-02 Place of Origin:Made in China ... deep bass sound Noise reduction function can be enabled in a variety of states, including Bluetooth on or off, plug-in state Soft protein memory foam ear pads with large ear cups provide comfortable wearing Metal stretchable arm, rotatable and foldable, |
Golden Promise Industrial Mfg.Co.,Ltd.
|