Sign In | Join Free | My futurenowinc.com
futurenowinc.com
Products
Search by Category
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request

noise proof ear plugs

All noise proof ear plugs wholesalers & noise proof ear plugs manufacturers come from members. We doesn't provide noise proof ear plugs products or service, please contact them directly and verify their companies info carefully.

Total 9915 products from noise proof ear plugs Manufactures & Suppliers
Wholesale Shipyard 33dB NRR Waterproof Noise Reduction Ear Plugs ANSI AS NZS from china suppliers

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a

JIAXING FUXING IMP. AND EXP. CO.,LTD
Active Member

Zhejiang

Wholesale PU Plastic Soft Ear Plugs , Noise Reduction Ear Plugs Super Flexibility from china suppliers

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plastic material, which has the advantage of

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

Wholesale Waterproof Safety Foam Ear Plugs 26.4dB 23.6inch 60cm Reusable Noise Cancelling Ear Plugs from china suppliers

Brand Name:Futuretech

Model Number:FTFE-02

Place of Origin:Shenzhen

... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded ear plugs in various colors including light blue, black, pink, green, orange and yellow, enough for your daily use; The cord is approx. 60 ...

FUTURE TECH LIMITED
Verified Supplier

Wholesale E-1013 Bullet Type Sound Proof Ear Plugs For Sleeping Soft Resilient Material from china suppliers

Brand Name:SAFEYEAR

Model Number:E-1013

Place of Origin:CHINA

E-1013 Bullet Type Earplug For Good Sleeping Soft Resilient Material * Use: Improve sleep, concentrate on the spirit, protect hearing, etc. * Place: Can be used in homes, dormitories, classrooms, construction sites, factories and other places. * Efficacy: ...

Shanghai Workplus Technology Co.,ltd
Active Member

Shanghai

Wholesale Flexible Shooting Ear Plugs ROHS Custom Silicone Parts from china suppliers

Brand Name:OEM

Model Number:OEM

Place of Origin:CHINA

... use sealing characteristics of silicone material then designed to meet the human ear structure, a rubber ear plug can protect the eardrum by noise damage effectively. Silicone Ear Plugs are common used in electronic products to output voice,swimming to

Xiamen Juguangli Import & Export Co., Ltd
Verified Supplier

Fujian

Wholesale OEM Pyrex Glass Ear Plugs 13mm Stainless Steel Handmade Piercing Jewelry from china suppliers

Brand Name:Golden Moon

Model Number:YH-EK0322

Place of Origin:China

... effect , handmade piercing jewelry , from 4 gauge to 1" , 13mm high , also can do other color Keywords: Ear Plug Tunnels OEM/ODM: Acceptable Piercing Plugs: Ear Plug Payment: T/T,Paypal Shipping Method: By Express Style: Hiphop,piercing Body Jewelry Type:

Shenzhen Golden Moon Trade Ltd.
Active Member

Wholesale Soft Silicone Corded Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff from china suppliers

Brand Name:sweet

Model Number:HT-034

Place of Origin:Ningbo

...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs...

Sweet Home International(H.K.)Limited
Active Member

Zhejiang

Wholesale Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs from china suppliers

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

Wholesale Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women from china suppliers

Brand Name:YC

Model Number:YC-ED-0032

Place of Origin:China

Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women Product Description Product name Stud earrings Material Stainless steel Features Fine quality AAA Cubic Zircon, Copper with long lasting rhodium plating...

Guangzhou Pullman Jewelry Co., Ltd.
Active Member

Guangdong

Wholesale Pu Foam Ear Plugs from china suppliers

Place of Origin:China

Brand Name:DISHINE

Pu Foam Ear Plugs 【Description】 Sound insulation is made of PU foam, which is easy to put into your ear to keep away the noise. Each pair is packed with a easy-open plastic case. Your logo can be added on the case. Several colors are available. Pricing...

Dishine International Limited
Active Member

Zhejiang

Wholesale Explosion Proof Power Plug and Socket 16A 32A 63A 220VAC Anti Corrosion 4 Pins from china suppliers

Brand Name:Crown Extra

Model Number:AC8060

Place of Origin:China

... where there is a risk of explosive gases and dust. This product has a protection level of IP66, which makes it an ideal solution for use in harsh environments. The Explosion Proof Plug and

crown extra lighting co. ltd
Verified Supplier

Jiangsu

Wholesale IP55 BJ-YT/GZ-4 Explosion Proof 4Phase Plugs And Sockets High Quality Made in China from china suppliers

Brand Name:DOWE

Model Number:BJ-YT/GZ-4

Place of Origin:CHINA

IP55 BJ-YT/GZ-4 Explosion Proof 4Phase Plugs And Sockets Product Description Explosion Proof Plug Socket Explosion proof plug and socket receptacles rated 60A, voltage 110V to 480V for use within hazardous areas with potential explosive atmospheres zones...

Yueqing City DOWE Electric Co.,LTD
Site Member

Zhejiang

Wholesale Pu foam Ear plugs,Earplugs,Foam ear plugs ,CE EN 352-2 Bullet PU Foam Ear plugs from china suppliers

Place of Origin:yangzhou

Brand Name:Xinfly

Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description for earplug with metal tube: - Earplugs: PU foam earplug or silicone earplug with cord or without cord - ...

YANGZHOU XINFLY AMENITIES CO.,LTD
Active Member

Jiangsu

Wholesale 300V 10A M2.5 Screw Fixed Ear Plug-In Brass Terminal Block from china suppliers

Brand Name:ZHONGYI

Model Number:HQ2EDGKM-5.0/5.08

Place of Origin:China

HQ2EDGKM-5.0/5.08 mm pitch screw fixed ear plug-in type brass terminal block Pitch 5.0/5.08mm Screw M2.5.Steel.Zinc plated Wire guard Phosphor bronze.Ni plated Pin header Brass. Tin plated Rated voltage 300V Rated current 10A Withstanding voltage AC1500V/...

CIXI ZHONGYI ELECTRONIC EQUIPMENT FACTORY
Verified Supplier

Zhejiang

Wholesale noise canceling ear cushion protein PU leather plus memory foam for the gaming headphone from china suppliers

Brand Name:N/A

Model Number:HR260519

Place of Origin:MADE IN CHINA

PRODUCT NAME : noise canceling ear cushion protein PU leather plus memory foam for the gaming headphone Item number :HR260519 Materials : high protein PU leather + memory foam colour : black /grey/red /orange/ green

LUCKY GREAT INDUSTRY (HONG KONG ) LIMITED
Site Member

Guangdong

Wholesale Sport ear plug Bluetooth earphone run headphone with hook best sellers in 2017 from china suppliers

Brand Name:aomei

Model Number:PSE-010

Place of Origin:China

... plug, portability,steadiness and comfortable silica gal hook for ear. There are four fashion colors for choice,and the control buttons is on the right ear plug, this design will not be influence by the sweat. We are factory, the price is very competitive.

Zhongshan Aomei Trade Co.,Ltd
Active Member

Guangdong

Wholesale The Most Affordable Option for Airline Travel Noise Cancelling Ear Earphone in Many Vibrant Colors from china suppliers

Categories:3.5mm Single PIN earphone

Country/Region:china

Cheapest constellation in ear earphone with many colors Product Description Frequency 20-20,000 Hz Sensitivity 104±10%DB Impedance 32±2Ω Plug 3.5mm dual PIN Speaker 10mm Length 1.2m or customized Color multi Function Noise Cancelling Usage Airline,bus,...

Yichun Yuanzhou District Heshi Electronics Co., Ltd.
Verified Supplier

Wholesale Stereo Wireless blue tooth earphone earhook bone conduction headphones No Ear Plugs Headset from china suppliers

Place of Origin:Guangdong, China

Brand Name:OEM or Our brand

...bone conduction headphones No Ear Plugs Headset with Microphone TWS earbuds wireless earbuds wireless headset sport earphone Product description: Stereo Wireless blue tooth earphone earhook bone conduction headphones No Ear Plugs Headset with Microphone ...

Producentre (Dongguan) Electronic Co., Ltd
Active Member

Guangdong

Inquiry Cart 0