noise reduction cr sealed foam

Brand Name:HONTECK

Model Number:CR0515B

Place of Origin:China

... CR rubber and plastic products are new environment-friendly plastic foam materials. Good physical and mechanical properties,oil resistance,heat resistance,fire resistance,daylight resistance,ozone resistance,...

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product Parameters Model L -

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Brand Name:new top star

Model Number:IXPE3030-4

Place of Origin:china

...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam...

Brand Name:No brand

Model Number:EVA 30-G

Place of Origin:China

... overcome the minor subfloor imperfections and insulate the noise EVA underlay has a variety of applications. They can be used under Engineered wood floor, Luxury Vinyl tile, SPC tile and plank floorings and even ...

Brand Name:CYG

Model Number:4012

Place of Origin:China

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ...

Brand Name:Future Tech

Model Number:FT-EM5002

Place of Origin:Shenzhen China

...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam...

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Brand Name:Artshow

Model Number:B09

Place of Origin:China

... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology and sealed in-ear design limits background noise.

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Categories:Aluminum Roller Shutter Door

Country/Region:china

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam...

Brand Name:Qiu Zhuo

Model Number:QZ-1285697

Place of Origin:China

Product Description: Self Adhesive Caulking Strip The Self Adhesive Caulking Strip is a revolutionary product made from high-quality Polyethylene Foam. It is designed to provide an easy and effective solution for sound insulation and sealing gaps in your ...

Brand Name:LENGE

Model Number:GB820.610-150

Place of Origin:China

...: Galvanized Iron/stainless steel Separator: Aluminum foil/Offset paper Filter Media: Glass fibre Gasket: PU foam seal/CR seal strip Operation Conditions: <80%/100%RH, <80 ℃

Brand Name:NBR 70 rubber flat ring gasket

Model Number:Customized

Place of Origin:Guangdong,China

Electronic Nitrile Rubber Flat Ring Gasket Seal Noise Reduction Product For Weather Insulation Product Description We offer cylinder head gasket in a variety of elastomers, sizes and shapes and available in custom designed to meet almost any specification...

Brand Name:TINDA

Model Number:TINDA-SI-1168

Place of Origin:CHINA

Hot Air Seam Sealing Silicone Wheel Description: Our silicone wheels for YF 301 & H&H Sewing Hot Air Seam Sealing Machine, are also designed with noise reduction features, ensuring a quiet and efficient operation. This makes them perfect for use in ...