shipyard 33db noise reduction ear plugs

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

Description The Noise Ear Plugs realize the function to reduce work, home, sleep and safety noise. Due to the washable and reusable design, it is really friendly to the environment. As a matter of fact, it can be an ideal facility used for airplanes, ...

Brand Name:Future Tech

Model Number:FT-EM5002

Place of Origin:Shenzhen China

...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam for the best fit and low ontact pressure. 3. Good inner space for ear...

Brand Name:sweet

Model Number:HT-034

Place of Origin:Ningbo

...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs...

Brand Name:EARLISTEN

Model Number:promo

Place of Origin:CHINA

Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo plug 2. In ear type, Dual ear with MIC and refined MIC housing 3. high quality speaker, Hi-Fi sound quality 4. Stereo earphone with noise...

Brand Name:EARLISTEN

Model Number:promo

Place of Origin:CHINA

Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo plug 2. In ear type, Dual ear with MIC and refined MIC housing 3. high quality speaker, Hi-Fi sound quality 4. Stereo earphone with noise...

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-...

Categories:3.5mm Single PIN earphone

Country/Region:china

Product Description Material PVC+ABS Length Customized Color Multi Plug 3.5mmz,Single PIN Speaker 13mm Sensitivity 104±10%DB Frequency range 20-20,000 Hz Impedance 32±2Ω Company Profile Our Factory YICHUN YUANZHOU DISTRICT HESHI ELECTRONICS CO.,LTD Yichun ...

Brand Name:HYQ

Model Number:3404-FY148

Place of Origin:CHINA

...Ear Earphones Wired Earphone Information Item Number 3404-FY148 Communication Wired Earphone Color Multi color Plug 3.5mm straight plug Cable Flat cable Flat Cable Specification Impedance 24Ω±5Ω Speaker size 10MM Cable length 120CM Frequency range 20Hz-20KHz Sensitivity 100dB±5dB Max power input 10mW Feature High quality sound insulation Passive noise reduction...

Brand Name:onikuma

Model Number:k8

Place of Origin:China

...Ear Headphones with Volume Control LED Light Cool Style Stereo Noise Reduction Earphone features: Compatibility: With 3. 5mm audio cable jack (USB jack just work for LED light), wired stereo sound over ear gaming headset supports PC, Xbox One Controller(has 3. 5mm plug...

Brand Name:picun

Model Number:ANC-02

Place of Origin:Made in China

... deep bass sound Noise reduction function can be enabled in a variety of states, including Bluetooth on or off, plug-in state Soft protein memory foam ear pads with large ear cups provide comfortable wearing Metal stretchable arm, rotatable and foldable,

Brand Name:JBL

Model Number:Q100

... Over-ear Noise Cancelling Active Noise Cancellation (ANC) Control Method button control Function Adaptive noise reduction function Principle of Sound Production moving coil Type of headphone plug 3.5 mm Packaging and delivery Selling Units Single item

Place of Origin:china

Brand Name:OEM

Model Number:KBT-8252

...3.5 plug audio cable to connect the headset to enjoy high quality music playback, good noise reduction function, functional. Bluetooth headset with pure piano paint appearance design, filling the atmosphere; full-size protein skin comfort ear, comfortable...